Protein or peptide name:NsiR6
Chromosome:Synechocystis sp. PCC 6803, complete genome
Protein or peptide start site:729173
Protein or peptide end site:729370
ncRNA start site:729173
ncRNA end site:729370
Genome Browser:NA
Protein or peptide sequence:MSVFPAETCPVCGVTIENGSKVVFSSGPAGTRARLWARVCNFARNTSCINQDEAAIGNVSSRDYYD
Protein or peptide length:66aa
ncRNA type:ncRNA
ncRNA name:nsiR6
Entrez ID:NA
Experimental species:Cyanobacteria
Experimental techniques:Western blotting
Experimental sample (cell line and/or tissue):Synechocystis sp. PCC 6803
Description:To verify the existence of the respective μ-proteins in vivo, we selected five genes as examples to which a FLAG tag sequence was added and re-introduced them into Synechocystis sp. PCC 6803. These were the previously annotated gene ssr1169, two newly defined genes norf1 and norf4, as well as nsiR6 (nitrogen stress-induced RNA 6) and hliR1 (high light-inducible RNA 1), which originally were considered non-coding.
Subcellular location:NA
Function:Hence, the putative cysteine pairs in NsiR6 may confer redox control or metal binding.
Title of paper:Small proteins in cyanobacteria provide a paradigm for the functional analysis of the bacterial micro-proteome
PMID:27894276
Year of publication:2016